Description
LL-37 (CAP-18) 5mg: Premium Industrial Grade Peptide for Research Applications
In the advanced field of industrial chemical procurement, precision, purity, and consistency are essential requirements that drive purchasing decisions for research facilities and pharmaceutical development. SwissyNeu has established itself as a premier provider of industrial-grade LL-37 (CAP-18) 5mg, delivering products that meet the exacting standards required for sophisticated research applications. Our commitment to excellence has positioned us as a trusted partner in the global chemical marketplace.
Understanding LL-37 (CAP-18): Properties and Industrial Applications
LL-37, also known as CAP-18, is a 37-amino acid cathelicidin peptide ([LL-37, 37 aa]) that represents the only known human cathelicidin. This naturally occurring peptide demonstrates remarkable antimicrobial properties and plays a crucial role in the innate immune response. As a member of the cathelicidin family, LL-37 exhibits broad-spectrum activity against various microorganisms, making it particularly valuable for research in immunology and infectious disease.
With a molecular weight of 4493.24 g/mol and a chemical formula C205H340N60O65, LL-37 demonstrates specific biological activities that make it especially valuable in controlled research settings. Industrial researchers appreciate its stable molecular structure and predictable biological effects, which allow for consistent experimental outcomes across multiple research disciplines, particularly in studies related to immunology, microbiology, and inflammatory responses.
Quality Assurance and Manufacturing Standards
At SwissyNeu, our LL-37 (CAP-18) 5mg undergoes comprehensive quality control protocols to ensure batch-to-batch consistency and purity. Each production lot is subjected to rigorous analytical testing including high-performance liquid chromatography (HPLC), mass spectrometry, and nuclear magnetic resonance (NMR) spectroscopy. These analytical methods verify structural integrity, purity levels, and absence of contaminants that could compromise research results.
Our manufacturing facilities comply with current Good Manufacturing Practices (cGMP) and adhere to international quality standards including ISO 9001 certification. The production environment maintains controlled temperature, humidity, and air filtration systems to prevent degradation and contamination. Every batch of LL-37 (CAP-18) 5mg is accompanied by a detailed Certificate of Analysis (CoA) documenting specifications, test results, and compliance parameters.
Industrial Applications and Research Applications
Industrial-grade LL-37 (CAP-18) serves multiple research purposes across various sectors:
-
Immunology Research: Research laboratories utilize LL-37 in studies investigating innate immune responses, inflammatory processes, and host defense mechanisms against pathogenic microorganisms.
-
Microbiology Applications: Microbiology research centers employ LL-37 to investigate its antimicrobial properties against bacteria, fungi, and certain viruses, contributing to the development of novel antimicrobial strategies.
-
Wound Healing Studies: Research institutions explore LL-37’s potential role in tissue regeneration, wound healing processes, and cellular migration dynamics.
-
Dermatology Research: Scientists utilize LL-37 in studies related to skin biology, inflammatory skin conditions, and potential therapeutic applications for dermatological disorders.
-
Biotechnology Development: Biotech companies incorporate LL-37 in research exploring potential applications in medical devices, coatings, and other products requiring antimicrobial properties.
Bulk Procurement Advantages
SwissyNeu specializes in bulk chemical supply, offering significant advantages to industrial purchasers:
-
Volume-Based Pricing: Our tiered pricing structure provides cost efficiencies for larger volume purchases, allowing research institutions and industrial users to optimize their procurement budgets.
-
Consistent Supply Chain: With robust inventory management and reliable distribution networks, we ensure consistent product availability to support ongoing research programs without interruption.
-
Custom Packaging Options: We accommodate various packaging requirements, from standard vials to larger bulk containers, ensuring product integrity throughout storage and handling processes.
-
Technical Support: Our experienced technical team provides comprehensive support regarding product handling, storage recommendations, and application guidance to maximize research efficiency.
Global Distribution and Compliance
SwissyNeu maintains a sophisticated global distribution network capable of delivering LL-37 (CAP-18) 5mg to research facilities worldwide. Our logistics operations comply with international shipping regulations for chemical compounds, including proper documentation, packaging standards, and temperature-controlled transportation when necessary.
We navigate complex regulatory landscapes across different jurisdictions, ensuring compliance with local chemical import regulations, safety standards, and documentation requirements. Our regulatory affairs team stays current with evolving international chemical control regulations to maintain uninterrupted supply chains for our global clientele.
Technical Specifications
Our industrial-grade LL-37 (CAP-18) 5mg meets the following specifications:
- Purity: ≥98% (HPLC)
- Appearance: White lyophilized powder
- Molecular Formula: C205H340N60O65
- Molecular Weight: 4493.24 g/mol
- Storage Conditions: Store at -20°C, protected from light
- Solubility: Soluble in sterile water or bacteriostatic water
- Stability: Stable for 24 months when stored properly
Ordering and Procurement Process
SwissyNeu has streamlined our procurement process to facilitate efficient bulk ordering:
-
Account Setup: New customers complete a straightforward verification process to establish an account, ensuring compliance with chemical distribution regulations.
-
Product Selection: Our detailed product catalog provides comprehensive specifications, allowing precise selection based on research requirements.
-
Bulk Quotation: For volume purchases, our sales team provides customized quotations tailored to specific quantity requirements and delivery destinations.
-
Secure Payment: We offer multiple secure payment options designed for B2B transactions, including purchase order processing for established institutional accounts.
-
Order Tracking: Customers receive real-time tracking information for all orders, enabling precise planning for research schedules and production timelines.
Why Choose SwissyNeu for LL-37 (CAP-18) 5mg?
In the competitive industrial chemical marketplace, SwissyNeu distinguishes itself through:
-
Product Excellence: Our unwavering commitment to quality ensures that every batch of LL-37 meets the highest industry standards for purity and consistency.
-
Technical Expertise: Our team of chemical specialists provides comprehensive support to optimize product selection and application for specific research needs.
-
Supply Reliability: Robust inventory management and global distribution capabilities ensure consistent product availability for ongoing research programs.
-
Customer-Centric Approach: We prioritize customer satisfaction through responsive service, technical support, and flexible procurement options tailored to institutional requirements.
For premium industrial-grade LL-37 (CAP-18) 5mg and comprehensive chemical procurement solutions, trust SwissyNeu to deliver quality, consistency, and reliability. Visit our website at swissyneu.com to explore our complete product catalog, access technical documentation, or connect with our sales team for your specific bulk chemical requirements.





Reviews
There are no reviews yet.